TB-500

TB-500 thymosin beta reference material – technical reference Thymosin Beta-4 Acetate – Verificado por Janoshik – lyophilized powder – laboratory research use only

$44.99

Agregar al carrito
TB-500 lyophilized reference material vial by Panda Peptides
TB-500
$44.99
9 researchers ordered this week
VERIFIED BATCH ACCESS

See the independent lab report before you buy.

Every listing links to its current Certificado de análisis from Janoshik Analytical, an independent third-party lab. Review the documented purity and identity/composition data for this batch.

Verify current COA
Independent Janoshik analytical report, surfaced immediately above Panda research-use compliance notice.
Product-specific reports
Primary Current batch report

98.48% HPLC purity · Batch PP2601 · Tested size 5mg · Janoshik #113211

Laboratory Research Use Only. Not for use in diagnostic procedures. This product is solely intended for controlled in vitro laboratory research as a chemical reference compound. Product information is provided for educational and documentation purposes. It should only be handled by qualified laboratory professionals and must not be misrepresented, misused, or mislabeled as a drug, food, cosmetic, or medical device. By purchasing from Panda Peptides, you acknowledge that you are acquiring a compuesto para investigación.

TB-500 is a thymosin beta reference material, also identified as Thymosin Beta-4 Acetate in technical documentation. It is supplied as a high-purity lyophilized powder for controlled in vitro laboratory research use only.

Especificaciones del compuesto

Thymosin Beta Reference Material – Laboratory Research Use Only

Detalles del producto

  • Tamaños: 5mg, 10mg
  • Compuesto: TB-500
  • Technical reference: Thymosin Beta-4 Acetate
  • Peptide Length: 43 amino acids
  • Secuencia: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • CAS: 77591-33-4
  • Molecular Weight: approximately 4963.5 Da
  • Forma: Polvo liofilizado
  • Quality: High-purity, batch documented
  • Pruebas: View COA documentation
  • Pruebas: Ver COA (Verificado por Janoshik) →