LL-37 is a synthetic cathelicidin-derived peptide reference compound used in controlled laboratory research involving amphipathic cationic peptide structure, membrane-associated assay systems, and host-defense peptide biophysics. This listing is for research use only and is not for human or animal consumption.
Batch status
This product is notify-only until LL-37 batch documentation is confirmed and reviewed. Use the notification option on this page to receive an email when the tested batch is posted for sale.
Compound Specifications
Product Details
- Compound: LL-37
- Also known as: Cathelicidin LL-37
- Sequence: [LL-37, 37 aa]
- Form: Lyophilized powder
- Amount: 5mg
- Batch documentation: Testing pending; COA will be posted after results are confirmed
- Testing: View COA (Verified by Janoshik) →
Research Context
LL-37 is described in the literature as a human cathelicidin-derived peptide sequence. Research models use LL-37 as a tool compound for studying peptide structure, cationic amphipathic sequence behavior, membrane-associated assay systems, and host-defense peptide biophysics in controlled laboratory settings.
Handling and Storage
Store lyophilized material cold, dry, and protected from light. This material is supplied only for qualified laboratory research and analytical use.
For research use only. Not for human or animal consumption.
