Add to cart
Sale!

TB-500

TB-500 acetate · Full-length 43-amino-acid peptide · Janoshik verified · Lyophilized powder · Laboratory research use only

Price range: $24.99 through $44.99

-26%
Add to Cart
TB-500 - lyophilized powder research peptide vial by Panda Peptides
TB-500
$24.99 $44.99Price range: $24.99 through $44.99
6 researchers ordered this week
ACH Bank Transfer Cash App Debit
VERIFIED BATCH ACCESS

See the independent lab report before you buy.

Every listing links to its current Certificate of Analysis from Janoshik Analytical, an independent third-party lab. Review the documented purity and identity/composition data for this batch.

Verify current COA
Independent Janoshik analytical report, surfaced immediately above Panda research-use compliance notice.
Laboratory Research Use Only. Not for use in diagnostic procedures. This product is solely intended for controlled in vitro laboratory research as a chemical reference compound. Product information is provided for educational and documentation purposes. It should only be handled by qualified laboratory professionals and must not be misrepresented, misused, or mislabeled as a drug, food, cosmetic, or medical device. By purchasing from Panda Peptides, you acknowledge that you are acquiring a research chemical.

TB-500 is Thymosin Beta-4 Acetate, a full-length 43-amino-acid peptide supplied as a high-purity lyophilized powder for controlled in vitro laboratory research use only.

Compound Specifications

Thymosin Beta-4 Acetate — Laboratory Research Use Only

Product Details

  • Sizes: 5mg, 10mg
  • Compound: TB-500 (Thymosin Beta-4 Acetate)
  • Peptide Length: 43 amino acids
  • Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • CAS: 77591-33-4
  • Molecular Weight: approximately 4963.5 Da
  • Form: Lyophilized powder
  • Quality: High-purity, batch documented
  • Testing: View COA documentation →
  • Testing: View COA (Verified by Janoshik) →