Panda Peptides TB-500 - 10mg product vial
COA - TB-500 - 113211
Add to cart
Panda Peptides NAD+ 500mg product vial NAD+ 500mg Original price was: $39.99.Current price is: $38.39.

TB-500

TB-500 thymosin beta reference material – technical reference Thymosin Beta-4 Acetate – Janoshik verified – lyophilized powder – laboratory research use only

$44.99

Add to Cart
Panda Peptides TB-500 - 10mg product vial
TB-500
$44.99
7 researchers ordered this week
Frequently Purchased Together
Panda Peptides BPC-157 - 5mg product vial
BPC-157 Price range: $24.99 through $44.99
Select options
Panda Peptides GHK-Cu 50mg product vial
GHK-Cu Price range: $26.87 through $47.99
Select options

Payment options

Credit & debit cardsMajor card brands accepted
Zelle Cash App

Apple Pay & Google Pay on supported devices.

Shipping policy Return policy

Sold by the vial. Quantity 1 = one vial. Vial size & quantity guide

PUBLISHED DOCUMENTATION

Review the report and its scope before ordering.

Published results describe the samples, sizes and batches identified in each report. A report for one size or batch does not establish results for other sizes or batches.

Verify report
Consult the original report for analytical methods, results and limitations.

Primary report size: 5mg. Catalog options: 5mg / 10mg.

Review additional or historical reports under their own labels. Match the size and batch to the report; availability does not establish analytical coverage.

Product-specific reports
Primary Current batch report

98.48% HPLC purity · Batch PP2601 · Tested size 5mg · Janoshik #113211

Verify with Lab Open Full COA
Laboratory Research Use Only. Not for use in diagnostic procedures. This product is solely intended for controlled in vitro laboratory research as a chemical reference compound. Product information is provided for educational and documentation purposes. It should only be handled by qualified laboratory professionals and must not be misrepresented, misused, or mislabeled as a drug, food, cosmetic, or medical device. By purchasing from Panda Peptides, you acknowledge that you are acquiring a research chemical.

TB-500 is a thymosin beta reference material, also identified as Thymosin Beta-4 Acetate in technical documentation. It is supplied as a high-purity lyophilized powder for controlled in vitro laboratory research use only.

Compound Specifications

Thymosin Beta Reference Material – Laboratory Research Use Only

Product Details

  • Sizes: 5mg, 10mg
  • Compound: TB-500
  • Technical reference: Thymosin Beta-4 Acetate
  • Peptide Length: 43 amino acids
  • Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • CAS: 77591-33-4
  • Molecular Weight: approximately 4963.5 Da
  • Form: Lyophilized powder
  • Quality: High-purity, batch documented
  • Testing: View COA documentation
  • Testing: View COA (Verified by Janoshik Analytical) →
SKU: PP-038 Category: