TB-500 - lyophilized powder research peptide vial by Panda Peptides
Certificate of Analysis (COA) for TB-500 - third-party lab testing by Janoshik Analytical
Add to cart
NAD+ - lyophilized powder research peptide vial by Panda Peptides NAD+ 500mg Original price was: $49.99.Current price is: $36.00.
Sale!

TB-500

TB-500 acetate · Full-length 43-amino-acid peptide · Janoshik verified · Lyophilized powder · Laboratory research use only

Lab reports · Quality & testing · Research framework · About Panda · Published research

Price range: $24.99 through $44.99

-26%
Add to Cart
TB-500 - lyophilized powder research peptide vial by Panda Peptides
TB-500
$24.99 – $44.99Price range: $24.99 through $44.99
8 researchers ordered this week
ACH Bank Transfer Cash App Debit
You May Also Like
BPC-157 - lyophilized powder research peptide vial by Panda Peptides
BPC-157 Price range: $24.99 through $44.99
Select options
GHK-Cu - lyophilized powder research peptide vial by Panda Peptides
GHK-Cu Price range: $24.99 through $47.64
Get notified
VERIFIED BATCH ACCESS

See the independent lab report before you buy.

Every listing links to its current Certificate of Analysis from Janoshik Analytical, an independent third-party lab. Review the documented purity and identity/composition data for this batch.

Verify current COA
Independent Janoshik analytical report, surfaced immediately above Panda research-use compliance notice.
Laboratory Research Use Only. Not for use in diagnostic procedures. This product is solely intended for controlled in vitro laboratory research as a chemical reference compound. Product information is provided for educational and documentation purposes. It should only be handled by qualified laboratory professionals and must not be misrepresented, misused, or mislabeled as a drug, food, cosmetic, or medical device. By purchasing from Panda Peptides, you acknowledge that you are acquiring a research chemical.

TB-500 is Thymosin Beta-4 Acetate, a full-length 43-amino-acid peptide supplied as a high-purity lyophilized powder for controlled in vitro laboratory research use only.

Compound Specifications

Thymosin Beta-4 Acetate — Laboratory Research Use Only

Product Details

  • Sizes: 5mg, 10mg
  • Compound: TB-500 (Thymosin Beta-4 Acetate)
  • Peptide Length: 43 amino acids
  • Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • CAS: 77591-33-4
  • Molecular Weight: approximately 4963.5 Da
  • Form: Lyophilized powder
  • Quality: High-purity, batch documented
  • Testing: View COA documentation →
  • Testing: View COA (Verified by Janoshik) →
SKU: PP-038 Category: