Add to cart
Sale!

TB-500

TB-500 thymosin beta reference material – technical reference Thymosin Beta-4 Acetate – Janoshik verified – lyophilized powder – laboratory research use only

Price range: $24.99 through $44.99

-26%
Add to Cart
TB-500 lyophilized reference material vial by Panda Peptides
TB-500
$24.99 $44.99Price range: $24.99 through $44.99
2 researchers ordered this week
ACH Bank Transfer Cash App Debit
VERIFIED BATCH ACCESS

See the independent lab report before you buy.

Every listing links to its current Certificate of Analysis from Janoshik Analytical, an independent third-party lab. Review the documented purity and identity/composition data for this batch.

Verify current COA
Independent Janoshik analytical report, surfaced immediately above Panda research-use compliance notice.
Product-specific reports
Primary Current batch report

98.48% HPLC purity · Batch PP2601 · Tested size 5mg

Laboratory Research Use Only. Not for use in diagnostic procedures. This product is solely intended for controlled in vitro laboratory research as a chemical reference compound. Product information is provided for educational and documentation purposes. It should only be handled by qualified laboratory professionals and must not be misrepresented, misused, or mislabeled as a drug, food, cosmetic, or medical device. By purchasing from Panda Peptides, you acknowledge that you are acquiring a research chemical.

TB-500 is a thymosin beta reference material, also identified as Thymosin Beta-4 Acetate in technical documentation. It is supplied as a high-purity lyophilized powder for controlled in vitro laboratory research use only.

Compound Specifications

Thymosin Beta Reference Material – Laboratory Research Use Only

Product Details

  • Sizes: 5mg, 10mg
  • Compound: TB-500
  • Technical reference: Thymosin Beta-4 Acetate
  • Peptide Length: 43 amino acids
  • Sequence: SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • CAS: 77591-33-4
  • Molecular Weight: approximately 4963.5 Da
  • Form: Lyophilized powder
  • Quality: High-purity, batch documented
  • Testing: View COA documentation
  • Testing: View COA (Verified by Janoshik) →